KCNE2 (NM_172201) Human Mass Spec Standard
CAT#: PH311320
KCNE2 MS Standard C13 and N15-labeled recombinant protein (NP_751951)
View other "KCNE2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | KCNE2 MS Standard C13 and N15-labeled recombinant protein (NP_751951) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211320 |
Predicted MW | 14.5 kDa |
Protein Sequence |
>RC211320 protein sequence
Red=Cloning site Green=Tags(s) MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVS TVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_751951 |
RefSeq Size | 809 |
RefSeq ORF | 369 |
Synonyms | ATFB4; LQT5; LQT6; MIRP1 |
Locus ID | 9992 |
Cytogenetics | 21q22.11 |
Summary | Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403536 | KCNE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403536 | Transient overexpression lysate of potassium voltage-gated channel, Isk-related family, member 2 (KCNE2) |
CNY 3,080.00 |
|
TP311320 | Recombinant protein of human potassium voltage-gated channel, Isk-related family, member 2 (KCNE2), 20 µg |
CNY 2,900.00 |