CCDC43 (NM_001099225) Human Mass Spec Standard
CAT#: PH311843
CCDC43 MS Standard C13 and N15-labeled recombinant protein (NP_001092695)
View other "CCDC43" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CCDC43 MS Standard C13 and N15-labeled recombinant protein (NP_001092695) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211843 |
Predicted MW | 16.6 kDa |
Protein Sequence |
>RC211843 representing NM_001099225
Red=Cloning site Green=Tags(s) MAAPSEVAAIAPGEGDGGGGGFGSWLDGRLEALGVDRAVYGAYILGILQEEEEEEKLDALQGILSAFLEE DSLLNICKEIVERWSETQNVVTKVKKEDEVQAIATLIEKQAQIVVKPRMVSEEEKQRKAALLAQYADVTD EEDSVPKHQCGRCP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001092695 |
RefSeq Size | 2088 |
RefSeq ORF | 462 |
Locus ID | 124808 |
Cytogenetics | 17q21.31 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408244 | CCDC43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420375 | CCDC43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408244 | Transient overexpression lysate of coiled-coil domain containing 43 (CCDC43), transcript variant 1 |
CNY 3,080.00 |
|
LY420375 | Transient overexpression lysate of coiled-coil domain containing 43 (CCDC43), transcript variant 2 |
CNY 3,080.00 |
|
PH311896 | CCDC43 MS Standard C13 and N15-labeled recombinant protein (NP_653210) |
CNY 14,250.00 |
|
TP311843 | Recombinant protein of human coiled-coil domain containing 43 (CCDC43), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP311896 | Recombinant protein of human coiled-coil domain containing 43 (CCDC43), transcript variant 1, 20 µg |
CNY 2,900.00 |