Adducin 2 (ADD2) (NM_017482) Human Mass Spec Standard
CAT#: PH312102
ADD2 MS Standard C13 and N15-labeled recombinant protein (NP_059516)
View other "Adducin 2" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ADD2 MS Standard C13 and N15-labeled recombinant protein (NP_059516) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212102 |
Predicted MW | 62.3 kDa |
Protein Sequence |
>RC212102 representing NM_017482
Red=Cloning site Green=Tags(s) MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAADLRQDFNLMEQKKRVTMILQSPSFREELEGL IQEQMKKGNNSSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHTADSLNLAKGERLMRCKISSV YRLLDLYGWAQLSDTYVTLRVSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSSCFPVDTTGFC LHSAIYAARPDVRCIIHLHTPATAAVSAMKWGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGP TCKILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQVSALSSAGGVENLILLEQEKHRPHEVGSVQWAGS TFGPMQKSRLGEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEIPATVTAFVFEEDGAPVPALR QHAQKQQKEKTRWLNTPNTYLRVNVADEVQRSMGSPRPKTTWMKADEVEKSSSGMPIRIENPNQFVPLYT DPQEVLEMRNKIREQNRQDVKSAGPQSQLLASVIAEKSRSPVEQRLPLTGGETCLPCLRGLVPGAGLQDP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_059516 |
RefSeq Size | 2775 |
RefSeq ORF | 1680 |
Synonyms | ADDB |
Locus ID | 119 |
Cytogenetics | 2p13.3 |
Summary | Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413766 | ADD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC413769 | ADD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419845 | ADD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413766 | Transient overexpression lysate of adducin 2 (beta) (ADD2), transcript variant beta-2 |
CNY 4,840.00 |
|
LY413769 | Transient overexpression lysate of adducin 2 (beta) (ADD2), transcript variant beta-4 |
CNY 3,080.00 |
|
LY419845 | Transient overexpression lysate of adducin 2 (beta) (ADD2), transcript variant beta-1 |
CNY 3,080.00 |
|
PH307895 | ADD2 MS Standard C13 and N15-labeled recombinant protein (NP_059522) |
CNY 19,520.00 |
|
PH309517 | ADD2 MS Standard C13 and N15-labeled recombinant protein (NP_001608) |
CNY 19,520.00 |
|
TP307895 | Recombinant protein of human adducin 2 (beta) (ADD2), transcript variant beta-4, 20 µg |
CNY 2,900.00 |
|
TP309517 | Recombinant protein of human adducin 2 (beta) (ADD2), transcript variant beta-1, 20 µg |
CNY 2,900.00 |
|
TP312102 | Recombinant protein of human adducin 2 (beta) (ADD2), transcript variant beta-2, 20 µg |
CNY 2,900.00 |
其它Adducin 2产品