PIP5K3 (PIKFYVE) (NM_152671) Human Mass Spec Standard
CAT#: PH312288
PIKFYVE MS Standard C13 and N15-labeled recombinant protein (NP_689884)
View other "PIP5K3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 4,840.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PIKFYVE MS Standard C13 and N15-labeled recombinant protein (NP_689884) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212288 |
Predicted MW | 50 kDa |
Protein Sequence |
>RC212288 representing NM_152671
Red=Cloning site Green=Tags(s) MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERAEGGQGEQQPL SGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALGDLRACTYCRKIALSYAHSTDSNSIGEDLNALS DSACSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTPLSTRLVSVQEDAGKSPARNRSAS ITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILLDSVQLKDLWKKICHHSSGMEFQDHRYW LRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLDCVSHHDQLFRDEYALYRPLQSTEFSET PSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISL NVELDNVNFHIKKPSKYPHVPPHPADQKGRR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_689884 |
RefSeq Size | 1661 |
RefSeq ORF | 1353 |
Synonyms | CFD; FAB1; HEL37; PIP5K; PIP5K3; ZFYVE29 |
Locus ID | 200576 |
Cytogenetics | 2q34 |
Summary | Phosphorylated derivatives of phosphatidylinositol (PtdIns) regulate cytoskeletal functions, membrane trafficking, and receptor signaling by recruiting protein complexes to cell- and endosomal-membranes. Humans have multiple PtdIns proteins that differ by the degree and position of phosphorylation of the inositol ring. This gene encodes an enzyme (PIKfyve; also known as phosphatidylinositol-3-phosphate 5-kinase type III or PIPKIII) that phosphorylates the D-5 position in PtdIns and phosphatidylinositol-3-phosphate (PtdIns3P) to make PtdIns5P and PtdIns(3,5)biphosphate. The D-5 position also can be phosphorylated by type I PtdIns4P-5-kinases (PIP5Ks) that are encoded by distinct genes and preferentially phosphorylate D-4 phosphorylated PtdIns. In contrast, PIKfyve preferentially phosphorylates D-3 phosphorylated PtdIns. In addition to being a lipid kinase, PIKfyve also has protein kinase activity. PIKfyve regulates endomembrane homeostasis and plays a role in the biogenesis of endosome carrier vesicles from early endosomes. Mutations in this gene cause corneal fleck dystrophy (CFD); an autosomal dominant disorder characterized by numerous small white flecks present in all layers of the corneal stroma. Histologically, these flecks appear to be keratocytes distended with lipid and mucopolysaccharide filled intracytoplasmic vacuoles. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, May 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis, Fc gamma R-mediated phagocytosis, Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407390 | PIKFYVE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY407390 | Transient overexpression lysate of phosphoinositide kinase, FYVE finger containing (PIKFYVE), transcript variant 3 |
CNY 4,840.00 |
|
TP312288 | Recombinant protein of human phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III (PIP5K3), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP330258 | Purified recombinant protein of Homo sapiens phosphoinositide kinase, FYVE finger containing (PIKFYVE), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP760677 | Purified recombinant protein of Human phosphoinositide kinase, FYVE finger containing (PIKFYVE), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |