MADCAM1 (NM_130762) Human Mass Spec Standard
CAT#: PH312381
MADCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_570118)
View other "MADCAM1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | MADCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_570118) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212381 |
Predicted MW | 29.3 kDa |
Protein Sequence |
>RC212381 representing NM_130762
Red=Cloning site Green=Tags(s) MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAV QSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVT PVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRL PGLELSHRQAIPASKPAGDQLPAALWTSSAVLGLLLLALPTYHLWKRCRHLAEDDTHPPASLRLLPQVSA WAGLRGTGQVGISPS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_570118 |
RefSeq Size | 1275 |
RefSeq ORF | 885 |
Synonyms | MACAM1 |
Locus ID | 8174 |
Cytogenetics | 19p13.3 |
Summary | The protein encoded by this gene is an endothelial cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin, and VLA-4 (alpha4beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin family and is similar to ICAM1 and VCAM1. At least seven alternatively spliced transcripts encoding different protein isoforms have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008] |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408927 | MADCAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408928 | MADCAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408927 | Transient overexpression lysate of mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 1 |
CNY 3,080.00 |
|
LY408928 | Transient overexpression lysate of mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 2 |
CNY 3,080.00 |
|
PH319060 | MADCAM1 MS Standard C13 and N15-labeled recombinant protein (NP_570116) |
CNY 19,520.00 |
|
TP312381 | Recombinant protein of human mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP319060 | Recombinant protein of human mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它MADCAM1产品