WFDC10A (NM_080753) Human Mass Spec Standard
CAT#: PH312400
WFDC10A MS Standard C13 and N15-labeled recombinant protein (NP_542791)
View other "WFDC10A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | WFDC10A MS Standard C13 and N15-labeled recombinant protein (NP_542791) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212400 |
Predicted MW | 8.9 kDa |
Protein Sequence |
>RC212400 protein sequence
Red=Cloning site Green=Tags(s) MAPQTLLPVLVLCVLLLQAQGGYRDKKRMQKTQLSPEIKVCQQQPKLYLCKHLCESHRDCQANNICCSTY CGNVCMSIL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_542791 |
RefSeq Size | 482 |
RefSeq ORF | 237 |
Synonyms | C20orf146; dJ688G8.3; WAP10 |
Locus ID | 140832 |
Cytogenetics | 20q13.12 |
Summary | This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409069 | WFDC10A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409069 | Transient overexpression lysate of WAP four-disulfide core domain 10A (WFDC10A) |
CNY 3,080.00 |
|
TP312400 | Recombinant protein of human WAP four-disulfide core domain 10A (WFDC10A), 20 µg |
CNY 2,900.00 |
其它WFDC10A产品