DDT (NM_001084392) Human Mass Spec Standard
CAT#: PH312637
DDT MS Standard C13 and N15-labeled recombinant protein (NP_001077861)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001077861) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212637 |
Predicted MW | 12.7 kDa |
Protein Sequence |
>RC212637 protein sequence
Red=Cloning site Green=Tags(s) MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001077861 |
RefSeq Size | 637 |
RefSeq ORF | 354 |
Synonyms | D-DT; DDCT; MIF-2; MIF2 |
Locus ID | 1652 |
Cytogenetics | 22q11.23 |
Summary | D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419969 | DDT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421266 | DDT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425972 | DDT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419969 | Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 1 |
CNY 3,080.00 |
|
LY421266 | Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 2 |
CNY 3,080.00 |
|
PH302047 | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001346) |
CNY 19,520.00 |
|
TP302047 | Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312637 | Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 2, 20 µg |
CNY 2,900.00 |