XRCC4 (NM_003401) Human Mass Spec Standard
CAT#: PH312684
XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_003392)
View other "XRCC4" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_003392) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212684 |
Predicted MW | 38.3 kDa |
Protein Sequence |
>RC212684 protein sequence
Red=Cloning site Green=Tags(s) MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003392 |
RefSeq Size | 1688 |
RefSeq ORF | 1008 |
Synonyms | SSMED |
Locus ID | 7518 |
Cytogenetics | 5q14.2 |
Summary | The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternate transcript variants such as NM_022406 are unlikely to be expressed in some individuals due to a polymorphism (rs1805377) in the last splice acceptor site. [provided by RefSeq, Oct 2019] |
Protein Families | Druggable Genome |
Protein Pathways | Non-homologous end-joining |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402930 | XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418718 | XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402930 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3 |
CNY 3,080.00 |
|
LY418718 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1 |
CNY 3,080.00 |
|
PH318029 | XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_072044) |
CNY 19,520.00 |
|
TP312684 | Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP318029 | Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3, 20 µg |
CNY 2,900.00 |