BAG5 (NM_001015048) Human Mass Spec Standard
CAT#: PH312765
BAG5 MS Standard C13 and N15-labeled recombinant protein (NP_001015048)
View other "BAG5" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | BAG5 MS Standard C13 and N15-labeled recombinant protein (NP_001015048) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212765 |
Predicted MW | 56 kDa |
Protein Sequence |
>RC212765 protein sequence
Red=Cloning site Green=Tags(s) MRFHWLPTLSEPFDRNQELETCIRPLWTPSGSACETEHNKSMDMGNQHPSISRLQEIQKEVKSVEQQVIG FSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNANHPHRIEIQNIFE EAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTGGKISLRKARYHTLTKICAVQEIIEDCMKK QPSLPLSEDAHPSVAKINFVMCEVNKARGVLIALLMGVNNNETCRHLSCVLSGLIADLDALDVCGRTEIR NYRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIEKVLKRMREIKNELLQAQNPSELYLSSKTE LQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKEALEKRKLFACEEHPSHKAVWNVLGNLSEI QGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKCKAARKQAVRLAQNILSYLDLKSDEWEY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001015048 |
RefSeq Size | 4866 |
RefSeq ORF | 1467 |
Synonyms | BAG-5 |
Locus ID | 9529 |
Cytogenetics | 14q32.33 |
Summary | The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417691 | BAG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423114 | BAG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY417691 | Transient overexpression lysate of BCL2-associated athanogene 5 (BAG5), transcript variant 2 |
CNY 3,080.00 |
|
LY423114 | Transient overexpression lysate of BCL2-associated athanogene 5 (BAG5), transcript variant 3 |
CNY 4,840.00 |
|
PH308518 | BAG5 MS Standard C13 and N15-labeled recombinant protein (NP_004864) |
CNY 19,520.00 |
|
TP308518 | Recombinant protein of human BCL2-associated athanogene 5 (BAG5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP312765 | Recombinant protein of human BCL2-associated athanogene 5 (BAG5), transcript variant 3, 20 µg |
CNY 2,900.00 |