METTL1 (NM_005371) Human Mass Spec Standard
CAT#: PH312768
METTL1 MS Standard C13 and N15-labeled recombinant protein (NP_005362)
View other "METTL1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | METTL1 MS Standard C13 and N15-labeled recombinant protein (NP_005362) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212768 |
Predicted MW | 31.3 kDa |
Protein Sequence |
>RC212768 representing NM_005371
Red=Cloning site Green=Tags(s) MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKK EKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSN AMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTH FEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005362 |
RefSeq Size | 1743 |
RefSeq ORF | 828 |
Synonyms | C12orf1; TRM8; TRMT8; YDL201w |
Locus ID | 4234 |
Cytogenetics | 12q14.1 |
Summary | This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411493 | METTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417349 | METTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411493 | Transient overexpression lysate of methyltransferase like 1 (METTL1), transcript variant 3 |
CNY 3,080.00 |
|
LY417349 | Transient overexpression lysate of methyltransferase like 1 (METTL1), transcript variant 1 |
CNY 3,080.00 |
|
TP312768 | Recombinant protein of human methyltransferase like 1 (METTL1), transcript variant 1, 20 µg |
CNY 2,900.00 |