SOD2 (NM_001024465) Human Mass Spec Standard
CAT#: PH312924
SOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001019636)
View other "SOD2" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SOD2 MS Standard C13 and N15-labeled recombinant protein (NP_001019636) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212924 |
Predicted MW | 24.8 kDa |
Protein Sequence |
>RC212924 protein sequence
Red=Cloning site Green=Tags(s) MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQ EALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASV GVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINW ENVTERYMACKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001019636 |
RefSeq Size | 1035 |
RefSeq ORF | 666 |
Synonyms | GClnc1; IPO-B; IPOB; Mn-SOD; MNSOD; MVCD6 |
Locus ID | 6648 |
Cytogenetics | 6q25.3 |
Summary | This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. [provided by RefSeq, Apr 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Huntington's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400235 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422510 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422511 | SOD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400235 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY422510 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
LY422511 | Transient overexpression lysate of superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
PH302330 | SOD2 MS Standard C13 and N15-labeled recombinant protein (NP_000627) |
CNY 19,520.00 |
|
TP302330 | Recombinant protein of human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312924 | Recombinant protein of human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720709 | Purified recombinant protein of Human superoxide dismutase 2, mitochondrial (SOD2), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,710.00 |