United States
Germany
Japan
United Kingdom
China
C20orf30 (TMEM230) (NM_001009924) Human Mass Spec Standard
CAT＃: PH313024
C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009924)
View other "C20orf30" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009924) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213024 |
| Predicted MW | 13.2 kDa |
| Protein Sequence |
>RC213024 protein sequence
Red=Cloning site Green=Tags(s) MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGY ISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001009924 |
| RefSeq Size | 1792 |
| RefSeq ORF | 360 |
| Synonyms | C20orf30; dJ1116H23.2.1; HSPC274 |
| Locus ID | 29058 |
| Cytogenetics | 20p13-p12.3 |
| Summary | This gene encodes a multi-pass transmembrane protein that belongs to the TMEM134/TMEM230 protein family. The encoded protein localizes to secretory and recycling vesicle in the neuron and may be involved in synaptic vesicles trafficking and recycling. Mutations in this gene may be linked to familial Parkinson's disease. [provided by RefSeq, Mar 2017] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415474 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423152 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423153 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415474 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 3 |
CNY 3,080.00 |
|
| LY423152 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 2 |
CNY 3,080.00 |
|
| LY423153 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 4 |
CNY 3,080.00 |
|
| PH301878 | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_054864) |
CNY 19,520.00 |
|
| PH324414 | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009925) |
CNY 14,250.00 |
|
| TP301878 | Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP313024 | Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP324414 | Purified recombinant protein of Homo sapiens chromosome 20 open reading frame 30 (C20orf30), transcript variant 4, 20 µg |
CNY 2,900.00 |
其它C20orf30产品
