TrkC (NTRK3) (NM_002530) Human Mass Spec Standard
CAT#: PH313333
NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_002521)
View other "TrkC" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 4,840.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_002521) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213333 |
Predicted MW | 92.8 kDa |
Protein Sequence |
>RC213333 representing NM_002530
Red=Cloning site Green=Tags(s) MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNAS INITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLT TLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLP EISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGF TLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHV EYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITT PSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNL SPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLR AHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGM SRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECIT QGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002521 |
RefSeq Size | 2818 |
RefSeq ORF | 2475 |
Synonyms | gp145(trkC); GP145-TrkC; TRKC |
Locus ID | 4916 |
Cytogenetics | 15q25.3 |
Summary | This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Neurotrophin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400902 | NTRK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400902 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2 |
CNY 4,840.00 |
|
PH303781 | NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_001007157) |
CNY 19,520.00 |
|
PH319113 | NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_001012338) |
CNY 19,520.00 |
|
TP303781 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP313333 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP319113 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP700136 | Purified recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP710140 | Recombinant protein of human mitotic spindle organizing protein 2A (MZT2A), residues 32-429aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |