United States
Germany
Japan
United Kingdom
China
C2orf88 (NM_001042520) Human Mass Spec Standard
CAT＃: PH313362
C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035985)
View other "C2orf88" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 3,080.00
Specifications
| Product Data | |
| Description | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035985) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213362 |
| Predicted MW | 11 kDa |
| Protein Sequence |
>RC213362 protein sequence
Red=Cloning site Green=Tags(s) MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDIL CDALQQWACNNIKYHDIPYIESEGP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035985 |
| RefSeq Size | 4007 |
| RefSeq ORF | 285 |
| Synonyms | smAKAP |
| Locus ID | 84281 |
| Cytogenetics | 2q32.2 |
| Summary | Binds to type I regulatory subunits of protein kinase A (PKA-RI) and may anchor/target them to the plasma membrane.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403155 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420957 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420958 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420959 | C2orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403155 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 4 |
CNY 3,080.00 |
|
| LY420957 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 1 |
CNY 3,080.00 |
|
| LY420958 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 3 |
CNY 3,080.00 |
|
| LY420959 | Transient overexpression lysate of chromosome 2 open reading frame 88 (C2orf88), transcript variant 2 |
CNY 3,080.00 |
|
| PH302987 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035984) |
CNY 19,520.00 |
|
| PH313211 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_115697) |
CNY 19,520.00 |
|
| PH324360 | C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035986) |
CNY 14,250.00 |
|
| TP302987 | Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP313211 | Recombinant protein of human hypothetical protein MGC13057 (MGC13057), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP313362 | Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP324360 | Purified recombinant protein of Homo sapiens hypothetical protein MGC13057 (MGC13057), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它C2orf88产品
