VTI1A (NM_145206) Human Mass Spec Standard
CAT#: PH313934
VTI1A MS Standard C13 and N15-labeled recombinant protein (NP_660207)
View other "VTI1A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | VTI1A MS Standard C13 and N15-labeled recombinant protein (NP_660207) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213934 |
Predicted MW | 25 kDa |
Protein Sequence |
>RC213934 representing NM_145206
Red=Cloning site Green=Tags(s) MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMY SNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAV ETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAI TFSVRRH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_660207 |
RefSeq Size | 4401 |
RefSeq ORF | 651 |
Synonyms | MMDS3; MVti1; Vti1-rp2; VTI1RP2 |
Locus ID | 143187 |
Cytogenetics | 10q25.2 |
Summary | The protein encoded by this gene is a member of the family of soluble N-ethylmaleimide-sensitive fusion protein-attachment protein receptors (SNAREs) that function in intracellular trafficking. This family member is involved in vesicular transport between endosomes and the trans-Golgi network. It is a vesicle-associated SNARE (v-SNARE) that interacts with target membrane SNAREs (t-SNAREs). Polymorphisms in this gene have been associated with binocular function, and also with susceptibility to colorectal and lung cancers. A recurrent rearrangement has been found between this gene and the transcription factor 7-like 2 (TCF7L2) gene in colorectal cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Families | Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407945 | VTI1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407945 | Transient overexpression lysate of vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A) |
CNY 3,080.00 |
|
TP313934 | Recombinant protein of human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A), 20 µg |
CNY 2,900.00 |