MUSTN1 (NM_205853) Human Mass Spec Standard
CAT#: PH314142
MUSTN1 MS Standard C13 and N15-labeled recombinant protein (NP_995325)
View other "MUSTN1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | MUSTN1 MS Standard C13 and N15-labeled recombinant protein (NP_995325) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214142 |
Predicted MW | 8.9 kDa |
Protein Sequence |
>RC214142 protein sequence
Red=Cloning site Green=Tags(s) MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFE KPKAGPTKSVFG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_995325 |
RefSeq Size | 742 |
RefSeq ORF | 246 |
Synonyms | MUSTANG |
Locus ID | 389125 |
Cytogenetics | 3p21.1 |
Summary | May be involved in the development and regeneration of the musculoskeletal system.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404202 | MUSTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404202 | Transient overexpression lysate of musculoskeletal, embryonic nuclear protein 1 (MUSTN1) |
CNY 3,080.00 |
|
TP314142 | Recombinant protein of human musculoskeletal, embryonic nuclear protein 1 (MUSTN1), 20 µg |
CNY 2,900.00 |
|
TP710365 | Purified recombinant protein of human musculoskeletal, embryonic nuclear protein 1 (MUSTN1), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |