United States
Germany
Japan
United Kingdom
China
VAPA (NM_003574) Human Mass Spec Standard
CAT＃: PH314308
VAPA MS Standard C13 and N15-labeled recombinant protein (NP_003565)
View other "VAPA" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | VAPA MS Standard C13 and N15-labeled recombinant protein (NP_003565) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214308 |
| Predicted MW | 32.4 kDa |
| Protein Sequence |
>RC214308 representing NM_003574
Red=Cloning site Green=Tags(s) MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDP GSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLG ITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSV SLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVI AAIFIGFFLGKFIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003565 |
| RefSeq Size | 6994 |
| RefSeq ORF | 882 |
| Synonyms | hVAP-33; VAMP-A; VAP-33; VAP-A; VAP33 |
| Locus ID | 9218 |
| Cytogenetics | 18p11.22 |
| Summary | The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
| Protein Pathways | Tight junction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403661 | VAPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418581 | VAPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429151 | VAPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403661 | Transient overexpression lysate of VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 2 |
CNY 3,080.00 |
|
| LY418581 | Transient overexpression lysate of VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 1 |
CNY 3,080.00 |
|
| PH301164 | VAPA MS Standard C13 and N15-labeled recombinant protein (NP_919415) |
CNY 19,520.00 |
|
| TP301164 | Recombinant protein of human VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP314308 | Recombinant protein of human VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa (VAPA), transcript variant 1, 20 µg |
CNY 2,900.00 |
