Aminomethyltransferase (AMT) (NM_000481) Human Mass Spec Standard
CAT#: PH314343
AMT MS Standard C13 and N15-labeled recombinant protein (NP_000472)
View other "Aminomethyltransferase" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | AMT MS Standard C13 and N15-labeled recombinant protein (NP_000472) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214343 |
Predicted MW | 43.8 kDa |
Protein Sequence |
>RC214343 representing NM_000481
Red=Cloning site Green=Tags(s) MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHTDSHL HTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHL YVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVM EVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEH TTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSG CPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000472 |
RefSeq Size | 2117 |
RefSeq ORF | 1209 |
Synonyms | GCE; GCST; GCVT; NKH |
Locus ID | 275 |
Cytogenetics | 3p21.31 |
Summary | This gene encodes one of four critical components of the glycine cleavage system. Mutations in this gene have been associated with glycine encephalopathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Protein Pathways | Glycine, serine and threonine metabolism, Metabolic pathways, Nitrogen metabolism, One carbon pool by folate |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424691 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431304 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431317 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431336 | AMT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424691 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY431304 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
LY431317 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
LY431336 | Transient overexpression lysate of aminomethyltransferase (AMT), nuclear gene encoding mitochondrial protein, transcript variant 4 |
CNY 3,080.00 |
|
TP314343 | Recombinant protein of human aminomethyltransferase (AMT), 20 µg |
CNY 2,900.00 |
其它Aminomethyltransferase产品