CA5A (NM_001739) Human Mass Spec Standard
CAT#: PH314555
CA5A MS Standard C13 and N15-labeled recombinant protein (NP_001730)
View other "CA5A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CA5A MS Standard C13 and N15-labeled recombinant protein (NP_001730) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214555 |
Predicted MW | 34.75 kDa |
Protein Sequence |
>RC214555 representing NM_001739
Red=Cloning site Green=Tags(s) MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQ WRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGG SEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARA AMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNN YRPLQPLMNRKVWASFQATNEGTRS SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001730 |
RefSeq Size | 1084 |
RefSeq ORF | 915 |
Synonyms | CA5; CA5AD; CAV; CAVA; GS1-21A4.1 |
Locus ID | 763 |
Cytogenetics | 16q24.2 |
Summary | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419773 | CA5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419773 | Transient overexpression lysate of carbonic anhydrase VA, mitochondrial (CA5A), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP314555 | Recombinant protein of human carbonic anhydrase VA, mitochondrial (CA5A), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |