United States
Germany
Japan
United Kingdom
China
PPAR delta (PPARD) (NM_006238) Human Mass Spec Standard
CAT＃: PH314735
PPARD MS Standard C13 and N15-labeled recombinant protein (NP_006229)
View other "PPAR delta" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 4,840.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | PPARD MS Standard C13 and N15-labeled recombinant protein (NP_006229) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC214735 |
| Predicted MW | 49.7 kDa |
| Protein Sequence |
>RC214735 representing NM_006238
Red=Cloning site Green=Tags(s) MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSL NMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSH NAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAP FVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVT LLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLAL FIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI KKTETETSLHPLLQEIYKDMY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006229 |
| RefSeq Size | 3328 |
| RefSeq ORF | 1323 |
| Synonyms | FAAR; NR1C2; NUC1; NUCI; NUCII; PPARB |
| Locus ID | 5467 |
| Cytogenetics | 6p21.31 |
| Summary | This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. The encoded protein is thought to function as an integrator of transcriptional repression and nuclear receptor signaling. It may inhibit the ligand-induced transcriptional activity of peroxisome proliferator activated receptors alpha and gamma, though evidence for this effect is inconsistent. Expression of this gene in colorectal cancer cells may be variable but is typically relatively low. Knockout studies in mice suggested a role for this protein in myelination of the corpus callosum, lipid metabolism, differentiation, and epidermal cell proliferation. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
| Protein Pathways | Acute myeloid leukemia, Pathways in cancer, PPAR signaling pathway, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416782 | PPARD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC432912 | PPARD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433008 | PPARD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433089 | PPARD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416782 | Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 1 |
CNY 4,840.00 |
|
| LY432912 | Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 5 |
CNY 3,080.00 |
|
| LY433008 | Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 4 |
CNY 3,080.00 |
|
| LY433089 | Transient overexpression lysate of peroxisome proliferator-activated receptor delta (PPARD), transcript variant 3 |
CNY 3,080.00 |
|
| TP314735 | Recombinant protein of human peroxisome proliferator-activated receptor delta (PPARD), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它PPAR delta产品
