MTMR2 (NM_201281) Human Mass Spec Standard
CAT#: PH314811
MTMR2 MS Standard C13 and N15-labeled recombinant protein (NP_958438)
View other "MTMR2" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MTMR2 MS Standard C13 and N15-labeled recombinant protein (NP_958438) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214811 |
Predicted MW | 65.8 kDa |
Protein Sequence |
>RC214811 representing NM_201281
Red=Cloning site Green=Tags(s) MEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVINRVEKIGGAS SRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAFEYKEVFPENGWKLYDPL LEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATIT RCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLD IHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDGWD RTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTR QFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLYGSYSNH VLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSSSERASSP AQCVTPVQTVV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_958438 |
RefSeq Size | 4565 |
RefSeq ORF | 1713 |
Synonyms | CMT4B; CMT4B1 |
Locus ID | 8898 |
Cytogenetics | 11q21 |
Summary | This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Fructose and mannose metabolism, Metabolic pathways, Riboflavin metabolism, Thiamine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404513 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414151 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430848 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404513 | Transient overexpression lysate of myotubularin related protein 2 (MTMR2), transcript variant 3 |
CNY 3,080.00 |
|
LY414151 | Transient overexpression lysate of myotubularin related protein 2 (MTMR2), transcript variant 1 |
CNY 3,080.00 |
|
PH308703 | MTMR2 MS Standard C13 and N15-labeled recombinant protein (NP_057240) |
CNY 19,520.00 |
|
TP308703 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP314811 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP324099 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 2, 20 µg |
CNY 2,900.00 |