MSRB2 (NM_012228) Human Mass Spec Standard
CAT#: PH315002
MSRB2 MS Standard C13 and N15-labeled recombinant protein (NP_036360)
View other "MSRB2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MSRB2 MS Standard C13 and N15-labeled recombinant protein (NP_036360) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215002 |
Predicted MW | 21.47 kDa |
Protein Sequence |
>RC215002 representing NM_012228
Red=Cloning site Green=Tags(s) MGAGAETGRGQRAAAPERRHGRLLWLLRGLTLGTAPRRAVRGQAGGGGPGTAGIVGEAGSLATCELPLAK SEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSG SDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036360 |
RefSeq Size | 903 |
RefSeq ORF | 603 |
Synonyms | CBS-1; CBS1; CGI-131; MSRB; PILB |
Locus ID | 22921 |
Cytogenetics | 10p12.2 |
Summary | Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402169 | MSRB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402169 | Transient overexpression lysate of methionine sulfoxide reductase B2 (MSRB2) |
CNY 3,080.00 |
|
TP315002 | Recombinant protein of human methionine sulfoxide reductase B2 (MSRB2), 20 µg |
CNY 2,900.00 |