Adenylate Kinase 1 (AK1) (NM_000476) Human Mass Spec Standard
CAT#: PH315130
AK1 MS Standard C13 and N15-labeled recombinant protein (NP_000467)
View other "Adenylate Kinase 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | AK1 MS Standard C13 and N15-labeled recombinant protein (NP_000467) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215130 |
Predicted MW | 21.5 kDa |
Protein Sequence |
>RC215130 representing NM_000476
Red=Cloning site Green=Tags(s) MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLE TVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVD DNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000467 |
RefSeq Size | 2271 |
RefSeq ORF | 582 |
Synonyms | HTL-S-58j |
Locus ID | 203 |
Cytogenetics | 9q34.11 |
Summary | This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
其它Adenylate Kinase 1产品