ETS1 (NM_005238) Human Mass Spec Standard
CAT#: PH315203
ETS1 MS Standard C13 and N15-labeled recombinant protein (NP_005229)
View other "ETS1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ETS1 MS Standard C13 and N15-labeled recombinant protein (NP_005229) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215203 |
Predicted MW | 50.2 kDa |
Protein Sequence |
>RC215203 representing NM_005238
Red=Cloning site Green=Tags(s) MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPR QWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPY QVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVIL RDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRV PSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSC QSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS LLGYTPEELHAMLDVKPDADE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005229 |
RefSeq Size | 5228 |
RefSeq ORF | 1323 |
Synonyms | c-ets-1; ETS-1; EWSR2; p54 |
Locus ID | 2113 |
Cytogenetics | 11q24.3 |
Summary | This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Dorso-ventral axis formation, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401606 | ETS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428365 | ETS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401606 | Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) (ETS1), transcript variant 2 |
CNY 4,840.00 |
|
LY428365 | Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) (ETS1), transcript variant 1 |
CNY 3,080.00 |
|
TP315203 | Recombinant protein of human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) (ETS1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP761465 | Purified recombinant protein of Human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) (ETS1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2,040.00 |