SynCAM (CADM1) (NM_014333) Human Mass Spec Standard
CAT#: PH315477
CADM1 MS Standard C13 and N15-labeled recombinant protein (NP_055148)
View other "SynCAM" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CADM1 MS Standard C13 and N15-labeled recombinant protein (NP_055148) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215477 |
Predicted MW | 48.3 kDa |
Protein Sequence |
>RC215477 representing NM_014333
Red=Cloning site Green=Tags(s) MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSD DSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITV LVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVH KEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTW VRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTT TTTILTIITDSRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADA DTAIINAEGGQNNSEEKKEYFI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055148 |
RefSeq Size | 3512 |
RefSeq ORF | 1326 |
Synonyms | BL2; IGSF4; IGSF4A; Necl-2; NECL2; RA175; sgIGSF; ST17; sTSLC-1; SYNCAM; synCAM1; TSLC1 |
Locus ID | 23705 |
Cytogenetics | 11q23.3 |
Summary | Mediates homophilic cell-cell adhesion in a Ca(2+)-independent manner. Also mediates heterophilic cell-cell adhesion with CADM3 and NECTIN3 in a Ca(2+)-independent manner. Acts as a tumor suppressor in non-small-cell lung cancer (NSCLC) cells. Interaction with CRTAM promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo. May contribute to the less invasive phenotypes of lepidic growth tumor cells. In mast cells, may mediate attachment to and promote communication with nerves. CADM1, together with MITF, is essential for development and survival of mast cells in vivo. Acts as a synaptic cell adhesion molecule and plays a role in the formation of dendritic spines and in synapse assembly (By similarity). May be involved in neuronal migration, axon growth, pathfinding, and fasciculation on the axons of differentiating neurons. May play diverse roles in the spermatogenesis including in the adhesion of spermatocytes and spermatids to Sertoli cells and for their normal differentiation into mature spermatozoa.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402316 | CADM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC420615 | CADM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402316 | Transient overexpression lysate of cell adhesion molecule 1 (CADM1), transcript variant 1 |
CNY 4,840.00 |
|
LY420615 | Transient overexpression lysate of cell adhesion molecule 1 (CADM1), transcript variant 2 |
CNY 3,080.00 |
|
TP315477 | Recombinant protein of human cell adhesion molecule 1 (CADM1), transcript variant 1, 20 µg |
CNY 2,900.00 |