FGF12 (NM_021032) Human Mass Spec Standard
CAT#: PH315868
FGF12 MS Standard C13 and N15-labeled recombinant protein (NP_066360)
View other "FGF12" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FGF12 MS Standard C13 and N15-labeled recombinant protein (NP_066360) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215868 |
Predicted MW | 27.2 kDa |
Protein Sequence |
>RC215868 representing NM_021032
Red=Cloning site Green=Tags(s) MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQL KGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDV FTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYRE PSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066360 |
RefSeq Size | 2817 |
RefSeq ORF | 729 |
Synonyms | DEE47; EIEE47; FGF12B; FHF1 |
Locus ID | 2257 |
Cytogenetics | 3q28-q29 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. [provided by RefSeq, Dec 2019] |
Protein Families | Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412153 | FGF12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418206 | FGF12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412153 | Transient overexpression lysate of fibroblast growth factor 12 (FGF12), transcript variant 1 |
CNY 3,080.00 |
|
LY418206 | Transient overexpression lysate of fibroblast growth factor 12 (FGF12), transcript variant 2 |
CNY 3,080.00 |
|
TP315868 | Recombinant protein of human fibroblast growth factor 12 (FGF12), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720197 | Recombinant protein of human fibroblast growth factor 12 (FGF12), transcript variant 2 |
CNY 3,140.00 |