NCF4 (NM_000631) Human Mass Spec Standard
CAT#: PH316094
NCF4 MS Standard C13 and N15-labeled recombinant protein (NP_000622)
View other "NCF4" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | NCF4 MS Standard C13 and N15-labeled recombinant protein (NP_000622) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216094 |
Predicted MW | 38.9 kDa |
Protein Sequence |
>RC216094 representing NM_000631
Red=Cloning site Green=Tags(s) MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLE ERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDS EQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEG TVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000622 |
RefSeq Size | 1386 |
RefSeq ORF | 1017 |
Synonyms | CGD3; NCF; P40PHOX; SH3PXD4 |
Locus ID | 4689 |
Cytogenetics | 22q12.3 |
Summary | The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Pathways | Leukocyte transendothelial migration |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402260 | NCF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424600 | NCF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402260 | Transient overexpression lysate of neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2 |
CNY 3,080.00 |
|
LY424600 | Transient overexpression lysate of neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1 |
CNY 3,080.00 |
|
TP316094 | Recombinant protein of human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760264 | Recombinant protein of human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP760667 | Purified recombinant protein of Human neutrophil cytosolic factor 4, 40kDa (NCF4), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |