LRRC2 (NM_024512) Human Mass Spec Standard
CAT#: PH316196
LRRC2 MS Standard C13 and N15-labeled recombinant protein (NP_078788)
View other "LRRC2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LRRC2 MS Standard C13 and N15-labeled recombinant protein (NP_078788) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216196 |
Predicted MW | 42.8 kDa |
Protein Sequence |
>RC216196 representing NM_024512
Red=Cloning site Green=Tags(s) MGHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFID TSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYI QLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFEL SNLKQVTFVDISANKFSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSML NLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIE DLKERESVPSYTTKVSFSLQL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_078788 |
RefSeq Size | 4860 |
RefSeq ORF | 1113 |
Locus ID | 79442 |
Cytogenetics | 3p21.31 |
Summary | This gene encodes a member of the leucine-rich repeat-containing family of proteins, which function in diverse biological pathways. This family member may possibly be a nuclear protein. Similarity to the RAS suppressor protein, as well as expression down-regulation observed in tumor cells, suggests that it may function as a tumor suppressor. The gene is located in the chromosome 3 common eliminated region 1 (C3CER1), a 1.4 Mb region that is commonly deleted in diverse tumors. A related pseudogene has been identified on chromosome 2. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411101 | LRRC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411257 | LRRC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411101 | Transient overexpression lysate of leucine rich repeat containing 2 (LRRC2), transcript variant 2 |
CNY 3,080.00 |
|
LY411257 | Transient overexpression lysate of leucine rich repeat containing 2 (LRRC2), transcript variant 1 |
CNY 3,080.00 |
|
PH306380 | LRRC2 MS Standard C13 and N15-labeled recombinant protein (NP_079026) |
CNY 19,520.00 |
|
TP306380 | Recombinant protein of human leucine rich repeat containing 2 (LRRC2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP316196 | Recombinant protein of human leucine rich repeat containing 2 (LRRC2), transcript variant 1, 20 µg |
CNY 2,900.00 |