United States
Germany
Japan
United Kingdom
China
CDC42 (NM_044472) Human Mass Spec Standard
CAT＃: PH316559
CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_426359)
View other "CDC42" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_426359) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216559 |
| Predicted MW | 21.1 kDa |
| Protein Sequence |
>RC216559 representing NM_044472
Red=Cloning site Green=Tags(s) MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPL SYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPE TAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPPETQPKRKCCIF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_426359 |
| RefSeq Size | 1135 |
| RefSeq ORF | 573 |
| Synonyms | CDC42Hs; G25K; TKS |
| Locus ID | 998 |
| Cytogenetics | 1p36.12 |
| Summary | The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20. [provided by RefSeq, Apr 2013] |
| Protein Families | Druggable Genome |
| Protein Pathways | Adherens junction, Axon guidance, Chemokine signaling pathway, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, Fc gamma R-mediated phagocytosis, Focal adhesion, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, Pancreatic cancer, Pathogenic Escherichia coli infection, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Tight junction, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400679 | CDC42 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409470 | CDC42 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421832 | CDC42 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400679 | Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1 |
CNY 3,080.00 |
|
| LY409470 | Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2 |
CNY 3,080.00 |
|
| LY421832 | Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3 |
CNY 3,080.00 |
|
| PH314076 | CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_001782) |
CNY 19,520.00 |
|
| PH319153 | CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_001034891) |
CNY 19,520.00 |
|
| TP314076 | Recombinant protein of human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP316559 | Recombinant protein of human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP319153 | Recombinant protein of human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, 20 µg |
CNY 2,900.00 |
