AGRP (NM_001138) Human Mass Spec Standard
CAT#: PH317144
AGRP MS Standard C13 and N15-labeled recombinant protein (NP_001129)
View other "AGRP" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | AGRP MS Standard C13 and N15-labeled recombinant protein (NP_001129) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217144 |
Predicted MW | 14.4 kDa |
Protein Sequence |
>RC217144 protein sequence
Red=Cloning site Green=Tags(s) MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQAL AEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001129 |
RefSeq Size | 783 |
RefSeq ORF | 396 |
Synonyms | AGRT; ART; ASIP2 |
Locus ID | 181 |
Cytogenetics | 16q22.1 |
Summary | This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. [provided by RefSeq, Dec 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Adipocytokine signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416046 | AGRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420100 | AGRP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416046 | Transient overexpression lysate of agouti related protein homolog (mouse) (AGRP), transcript variant 2 |
CNY 3,080.00 |
|
LY420100 | Transient overexpression lysate of agouti related protein homolog (mouse) (AGRP) |
CNY 3,080.00 |
|
TP317144 | Recombinant protein of human agouti related protein homolog (mouse) (AGRP), transcript variant 1, 20 µg |
CNY 2,900.00 |