MFGE8 (NM_005928) Human Mass Spec Standard
CAT#: PH317163
MFGE8 MS Standard C13 and N15-labeled recombinant protein (NP_005919)
View other "MFGE8" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MFGE8 MS Standard C13 and N15-labeled recombinant protein (NP_005919) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217163 |
Predicted MW | 42.9 kDa |
Protein Sequence |
>RC217163 representing NM_005928
Red=Cloning site Green=Tags(s) MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKC VEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTG VVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPT SCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVA GSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDN HSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005919 |
RefSeq Size | 1934 |
RefSeq ORF | 1161 |
Synonyms | BA46; EDIL1; HMFG; hP47; HsT19888; MFG-E8; MFGM; OAcGD3S; SED1; SPAG10 |
Locus ID | 4240 |
Cytogenetics | 15q26.1 |
Summary | This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401796 | MFGE8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426493 | MFGE8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401796 | Transient overexpression lysate of milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 1 |
CNY 3,080.00 |
|
LY426493 | Transient overexpression lysate of milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 2 |
CNY 3,080.00 |
|
TP317163 | Recombinant protein of human milk fat globule-EGF factor 8 protein (MFGE8), transcript variant 1, 20 µg |
CNY 2,900.00 |