FGF2 (NM_002006) Human Mass Spec Standard
CAT#: PH317426
FGF2 MS Standard C13 and N15-labeled recombinant protein (NP_001997)
View other "FGF2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | FGF2 MS Standard C13 and N15-labeled recombinant protein (NP_001997) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217426 |
Predicted MW | 30.6 kDa |
Protein Sequence |
>RC217426 representing NM_002006
Red=Cloning site Green=Tags(s) MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRT EERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSIT TLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGV CANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAIL FLPMSAKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001997 |
RefSeq Size | 6803 |
RefSeq ORF | 864 |
Synonyms | BFGF; FGF-2; FGFB; HBGF-2 |
Locus ID | 2247 |
Cytogenetics | 4q28.1 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400733 | FGF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400733 | Transient overexpression lysate of fibroblast growth factor 2 (basic) (FGF2) |
CNY 3,080.00 |
|
TP317426 | Recombinant protein of human fibroblast growth factor 2 (basic) (FGF2), 20 µg |
CNY 2,900.00 |
|
TP723719 | Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2) |
CNY 3,030.00 |
|
TP750002 | Recombinant protein of human Fibroblast Growth Factor-basic (FGF2) produced in E. coli |
CNY 2,040.00 |