BMAL1 (ARNTL) (NM_001030272) Human Mass Spec Standard
CAT#: PH317474
ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025443)
View other "BMAL1" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025443) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217474 |
Predicted MW | 68.7 kDa |
Protein Sequence |
>RC217474 protein sequence
Red=Cloning site Green=Tags(s) MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRI KNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPT FLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSS SDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKDRKSFCT IHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFV FVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWF SFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAG AGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQEN PGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001025443 |
RefSeq Size | 2808 |
RefSeq ORF | 1875 |
Synonyms | bHLHe5; BMAL1; BMAL1c; JAP3; MOP3; PASD3; TIC |
Locus ID | 406 |
Cytogenetics | 11p15.3 |
Summary | The protein encoded by this gene is a basic helix-loop-helix protein that forms a heterodimer with CLOCK. This heterodimer binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Defects in this gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Circadian rhythm - mammal |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400474 | ARNTL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422246 | ARNTL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422247 | ARNTL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400474 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1 |
CNY 3,080.00 |
|
LY422246 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2 |
CNY 4,840.00 |
|
LY422247 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3 |
CNY 3,080.00 |
|
PH304464 | ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025444) |
CNY 19,520.00 |
|
PH307870 | ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001169) |
CNY 19,520.00 |
|
TP304464 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP307870 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP317474 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2, 20 µg |
CNY 2,900.00 |