United States
Germany
Japan
United Kingdom
China
Kallikrein 5 (KLK5) (NM_001077491) Human Mass Spec Standard
CAT＃: PH317479
KLK5 MS Standard C13 and N15-labeled recombinant protein (NP_001070959)
View other "Kallikrein 5" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | KLK5 MS Standard C13 and N15-labeled recombinant protein (NP_001070959) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217479 |
| Predicted MW | 32 kDa |
| Protein Sequence |
>RC217479 protein sequence
Red=Cloning site Green=Tags(s) MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIING SDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSI PHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNIS VLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCK FTKWIQETIQANS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001070959 |
| RefSeq Size | 1435 |
| RefSeq ORF | 879 |
| Synonyms | KLK-L2; KLKL2; SCTE |
| Locus ID | 25818 |
| Cytogenetics | 19q13.41 |
| Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its expression is up-regulated by estrogens and progestins. The encoded protein is secreted and may be involved in desquamation in the epidermis. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease, Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402213 | KLK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421442 | KLK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421443 | KLK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425869 | KLK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402213 | Transient overexpression lysate of kallikrein-related peptidase 5 (KLK5), transcript variant 1 |
CNY 3,080.00 |
|
| LY421442 | Transient overexpression lysate of kallikrein-related peptidase 5 (KLK5), transcript variant 2 |
CNY 3,080.00 |
|
| LY421443 | Transient overexpression lysate of kallikrein-related peptidase 5 (KLK5), transcript variant 3 |
CNY 3,080.00 |
|
| LY425869 | Transient overexpression lysate of kallikrein-related peptidase 5 (KLK5), transcript variant 3 |
CNY 3,080.00 |
|
| TP317479 | Recombinant protein of human kallikrein-related peptidase 5 (KLK5), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Kallikrein 5产品
