TCF4 (NM_003199) Human Mass Spec Standard
CAT#: PH317718
TCF4 MS Standard C13 and N15-labeled recombinant protein (NP_003190)
View other "TCF4" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TCF4 MS Standard C13 and N15-labeled recombinant protein (NP_003190) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217718 |
Predicted MW | 71.1 kDa |
Protein Sequence |
>RC217718 representing NM_003199
Red=Cloning site Green=Tags(s) MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNVEDRSSSGSWGNGGHPSPSRN YGDGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLS PTKPGSQYYQYSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATST FPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPM STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVG SPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAMPGGHGDMHG IIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPP QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAE REKERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKA ACLKRREEEKVSSEPPPLSLAGPHPGMGDASNHMGQM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003190 |
RefSeq Size | 2500 |
RefSeq ORF | 2001 |
Synonyms | bHLHb19; CDG2T; E2-2; FECD3; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4 |
Locus ID | 6925 |
Cytogenetics | 18q21.2 |
Summary | This gene encodes transcription factor 4, a basic helix-loop-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is broadly expressed, and may play an important role in nervous system development. Defects in this gene are a cause of Pitt-Hopkins syndrome. In addition, an intronic CTG repeat normally numbering 10-37 repeat units can expand to >50 repeat units and cause Fuchs endothelial corneal dystrophy. Multiple alternatively spliced transcript variants that encode different proteins have been described. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401106 | TCF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421261 | TCF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401106 | Transient overexpression lysate of transcription factor 4 (TCF4), transcript variant 2 |
CNY 4,840.00 |
|
LY421261 | Transient overexpression lysate of transcription factor 4 (TCF4), transcript variant 1 |
CNY 4,840.00 |
|
PH324345 | TCF4 MS Standard C13 and N15-labeled recombinant protein (NP_001077431) |
CNY 19,520.00 |
|
TP317718 | Recombinant protein of human transcription factor 4 (TCF4), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP324345 | Recombinant protein of human transcription factor 4 (TCF4), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760702 | Purified recombinant protein of Human transcription factor 4 (TCF4), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |