United States
Germany
Japan
United Kingdom
China
PTBP1 (NM_031990) Human Mass Spec Standard
CAT＃: PH317785
PTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_114367)
View other "PTBP1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_114367) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217785 |
| Predicted MW | 58.9 kDa |
| Protein Sequence |
>RC217785 representing NM_031990
Red=Cloning site Green=Tags(s) MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDV TEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDS SPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTV LKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDL PSGDSQPSLDQTMAAAFASPYAGAGFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGL AGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHG KPIRITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLK VLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_114367 |
| RefSeq Size | 3300 |
| RefSeq ORF | 1650 |
| Synonyms | HNRNP-I; HNRNPI; HNRPI; pPTB; PTB; PTB-1; PTB-T; PTB2; PTB3; PTB4 |
| Locus ID | 5725 |
| Cytogenetics | 19p13.3 |
| Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410400 | PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410401 | PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419090 | PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410400 | Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 2 |
CNY 3,080.00 |
|
| LY410401 | Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 3 |
CNY 3,080.00 |
|
| LY419090 | Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 1 |
CNY 3,080.00 |
|
| PH301779 | PTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002810) |
CNY 19,520.00 |
|
| TP301779 | Recombinant protein of human polypyrimidine tract binding protein 1 (PTBP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP317785 | Recombinant protein of human polypyrimidine tract binding protein 1 (PTBP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
