SNF5 (SMARCB1) (NM_001007468) Human Mass Spec Standard
CAT#: PH317885
SMARCB1 MS Standard C13 and N15-labeled recombinant protein (NP_001007469)
View other "SNF5" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 3,600.00
CNY 3,080.00
Specifications
Product Data | |
Description | SMARCB1 MS Standard C13 and N15-labeled recombinant protein (NP_001007469) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217885 |
Predicted MW | 43.2 kDa |
Protein Sequence |
>RC217885 protein sequence
Red=Cloning site Green=Tags(s) MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHDH GYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCST TINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFS EILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENS PEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDA EMEKKIRDQDRNTRRMRRLANTAPAW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001007469 |
RefSeq Size | 1690 |
RefSeq ORF | 1128 |
Synonyms | BAF47; CSS3; hSNFS; INI1; MRD15; PPP1R144; RDT; RTPS1; Sfh1p; SNF5; SNF5L1; Snr1; SWNTS1 |
Locus ID | 6598 |
Cytogenetics | 22q11 |
Summary | The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401072 | SMARCB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423489 | SMARCB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401072 | Transient overexpression lysate of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 1 |
CNY 3,080.00 |
|
LY423489 | Transient overexpression lysate of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2 |
CNY 3,080.00 |
|
TP317885 | Recombinant protein of human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP762311 | Purified recombinant protein of Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (SMARCB1), transcript variant 1, Glu246-Asn380, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |