NSMCE1 (NM_145080) Human Mass Spec Standard
CAT#: PH318073
NSMCE1 MS Standard C13 and N15-labeled recombinant protein (NP_659547)
View other "NSMCE1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NSMCE1 MS Standard C13 and N15-labeled recombinant protein (NP_659547) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218073 |
Predicted MW | 30.7 kDa |
Protein Sequence |
>RC218073 representing NM_145080
Red=Cloning site Green=Tags(s) MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIE IKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNILNLVDQLKGKK MRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIR MHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNKKSLRSRQH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_659547 |
RefSeq Size | 1079 |
RefSeq ORF | 798 |
Synonyms | NSE1 |
Locus ID | 197370 |
Cytogenetics | 16p12.1 |
Summary | RING-type zinc finger-containing E3 ubiquitin ligase that assembles with melanoma antigen protein (MAGE) to catalyze the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. Within MAGE-RING ubiquitin ligase complex, MAGE stimulates and specifies ubiquitin ligase activity likely through recruitment and/or stabilization of the E2 ubiquitin-conjugating enzyme at the E3:substrate complex. Involved in maintenance of genome integrity, DNA damage response and DNA repair (PubMed:29225034, PubMed:20864041). NSMCE3/MAGEG1 and NSMCE1 ubiquitin ligase are components of SMC5-SMC6 complex and may positively regulate homologous recombination-mediated DNA repair (PubMed:18086888). MAGEF1-NSMCE1 ubiquitin ligase promotes proteasomal degradation of MMS19, a key component of the cytosolic iron-sulfur protein assembly (CIA) machinery. Down-regulation of MMS19 impairs the activity of several DNA repair and metabolism enzymes such as ERCC2/XPD, FANCJ, RTEL1 and POLD1 that require iron-sulfur clusters as cofactors (PubMed:29225034).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408050 | NSMCE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408050 | Transient overexpression lysate of non-SMC element 1 homolog (S. cerevisiae) (NSMCE1) |
CNY 3,080.00 |
|
TP318073 | Recombinant protein of human non-SMC element 1 homolog (S. cerevisiae) (NSMCE1), 20 µg |
CNY 2,900.00 |