RAB3IP (NM_022456) Human Mass Spec Standard
CAT#: PH318153
RAB3IP MS Standard C13 and N15-labeled recombinant protein (NP_071901)
View other "RAB3IP" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | RAB3IP MS Standard C13 and N15-labeled recombinant protein (NP_071901) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218153 |
Predicted MW | 51.1 kDa |
Protein Sequence |
>RC218153 representing NM_022456
Red=Cloning site Green=Tags(s) MANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYS SPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD SLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVRE ANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFKKGHTRNKSTSSAMSGS HQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVEN NTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTY IRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_071901 |
RefSeq Size | 1855 |
RefSeq ORF | 1380 |
Synonyms | RABIN3; RABIN8 |
Locus ID | 117177 |
Cytogenetics | 12q15 |
Summary | Guanine nucleotide exchange factor (GEF) which may activate RAB8A and RAB8B. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. Mediates the release of GDP from RAB8A and RAB8B but not from RAB3A or RAB5. Modulates actin organization and promotes polarized transport of RAB8A-specific vesicles to the cell surface. Together with RAB11A, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406273 | RAB3IP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411671 | RAB3IP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422524 | RAB3IP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406273 | Transient overexpression lysate of RAB3A interacting protein (rabin3) (RAB3IP), transcript variant beta 1 |
CNY 3,080.00 |
|
LY411671 | Transient overexpression lysate of RAB3A interacting protein (rabin3) (RAB3IP), transcript variant alpha 1 |
CNY 4,840.00 |
|
LY422524 | Transient overexpression lysate of RAB3A interacting protein (rabin3) (RAB3IP), transcript variant A |
CNY 3,080.00 |
|
TP318153 | Recombinant protein of human RAB3A interacting protein (rabin3) (RAB3IP), transcript variant alpha 1, 20 µg |
CNY 2,900.00 |
|
TP760069 | Recombinant protein of human RAB3A interacting protein (rabin3) (RAB3IP), transcript variant A, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |