SCARB1 (NM_001082959) Human Mass Spec Standard
CAT#: PH318270
SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001076428)
View other "SCARB1" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001076428) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218270 |
Predicted MW | 56 kDa |
Protein Sequence |
>RC218270 representing NM_001082959
Red=Cloning site Green=Tags(s) MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRAVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQGPEDTVSQPGLAAGPDRPPSPYT PLLPDSPSGQPPSPTA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001076428 |
RefSeq Size | 2630 |
RefSeq ORF | 1518 |
Synonyms | CD36L1; CLA-1; CLA1; HDLQTL6; SR-BI; SRB1 |
Locus ID | 949 |
Cytogenetics | 12q24.31 |
Summary | The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2019] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401684 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421197 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC425949 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401684 | Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 1 |
CNY 3,080.00 |
|
LY421197 | Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 2 |
CNY 4,840.00 |
|
PH310264 | SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_005496) |
CNY 19,520.00 |
|
TP310264 | Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP318270 | Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 2, 20 µg |
CNY 2,900.00 |