CAMLG (NM_001745) Human Mass Spec Standard
CAT#: PH318292
CAMLG MS Standard C13 and N15-labeled recombinant protein (NP_001736)
View other "CAMLG" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CAMLG MS Standard C13 and N15-labeled recombinant protein (NP_001736) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218292 |
Predicted MW | 33 kDa |
Protein Sequence |
>RC218292 protein sequence
Red=Cloning site Green=Tags(s) MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDS DKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLT ADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKY LSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFT FIFCHELLDYWGSEVP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001736 |
RefSeq Size | 2255 |
RefSeq ORF | 888 |
Synonyms | CAML; GET2 |
Locus ID | 819 |
Cytogenetics | 5q31.1 |
Summary | The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419768 | CAMLG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419768 | Transient overexpression lysate of calcium modulating ligand (CAMLG) |
CNY 3,080.00 |
|
TP318292 | Recombinant protein of human calcium modulating ligand (CAMLG), 20 µg |
CNY 2,900.00 |