alpha Defensin 1 (DEFA1) (NM_004084) Human Mass Spec Standard

Specifications

Product Data
Description	DEFA1 MS Standard C13 and N15-labeled recombinant protein (NP_004075)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC218421
Predicted MW	10 kDa
Protein Sequence	Sequence Link (showhide) >RC218421 representing NM_004084 Red=Cloning site Green=Tags(s) MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRI PACIAGERRYGTCIYQGRLWAFCC myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_004075
RefSeq Size	490
RefSeq ORF	282
Synonyms	DEF1; DEFA2; HNP-1; HP-1; HP1; MRS
Locus ID	1667
Cytogenetics	8p23.1
Summary	Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation. [provided by RefSeq, Oct 2014]
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.