IKB beta (NFKBIB) (NM_001001716) Human Mass Spec Standard
CAT#: PH318695
NFKBIB MS Standard C13 and N15-labeled recombinant protein (NP_001001716)
View other "IKB beta" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | NFKBIB MS Standard C13 and N15-labeled recombinant protein (NP_001001716) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218695 |
Predicted MW | 32.6 kDa |
Protein Sequence |
>RC218695 representing NM_001001716
Red=Cloning site Green=Tags(s) MNGATAAWAPWVRTQRPPEDLGWARSWARGCRGLPSSSATSLRMGTRFSAGTEYMDLQNDLGQTALHLAA ILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDT NHTPVALYPDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGR SPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGSAMLRPNPILARLLRAHGAPEPEGEDEKSGPCS SSSDSDSGDEGVSQEERQGSPAGGSG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001001716 |
RefSeq Size | 2213 |
RefSeq ORF | 918 |
Synonyms | IKBB; TRIP9 |
Locus ID | 4793 |
Cytogenetics | 19q13.2 |
Summary | The protein encoded by this gene belongs to the NF-kappa-B inhibitor family, which inhibit NF-kappa-B by complexing with, and trapping it in the cytoplasm. Phosphorylation of serine residues on these proteins by kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B, which translocates to the nucleus to function as a transcription factor. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jul 2011] |
Protein Families | Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Adipocytokine signaling pathway, B cell receptor signaling pathway, Chemokine signaling pathway, Cytosolic DNA-sensing pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419285 | NFKBIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424220 | NFKBIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425058 | NFKBIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419285 | Transient overexpression lysate of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta (NFKBIB), transcript variant 1 |
CNY 3,080.00 |
|
LY424220 | Transient overexpression lysate of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta (NFKBIB), transcript variant 2 |
CNY 3,080.00 |
|
PH302182 | NFKBIB MS Standard C13 and N15-labeled recombinant protein (NP_002494) |
CNY 19,520.00 |
|
TP302182 | Recombinant protein of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta (NFKBIB), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP318695 | Purified recombinant protein of Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta (NFKBIB), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它IKB beta产品