United States
Germany
Japan
United Kingdom
China
Ataxin 3 (ATXN3) (NM_004993) Human Mass Spec Standard
CAT＃: PH318923
ATXN3 MS Standard C13 and N15-labeled recombinant protein (NP_004984)
View other "Ataxin 3" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | ATXN3 MS Standard C13 and N15-labeled recombinant protein (NP_004984) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218923 |
| Predicted MW | 41.1 kDa |
| Protein Sequence |
>RC218923 representing NM_004993
Red=Cloning site Green=Tags(s) MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMD DSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGP ELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIRVQQMHRPKLIGEELAQLKEQRVHKTDLE RVLEANDGSGMLDEDEEDLQRALALSRQEIDMEDEEADLRRAIQLSMQGSSRNISQDMTQTSGTNLTSEE LRKRREAYFEKQQQKQQQQQQQQQQGDLSGQSSHPCERPATSSGALGSDLGDAMSEEDMLQAAVTMSLET VRNDLKTEGKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004984 |
| RefSeq Size | 2698 |
| RefSeq ORF | 1083 |
| Synonyms | AT3; ATX3; JOS; MJD; MJD1; SCA3 |
| Locus ID | 4287 |
| Cytogenetics | 14q32.12 |
| Summary | Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by this gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 12-44 to 52-86 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2016] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410754 | ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417607 | ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426854 | ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431255 | ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432176 | ATXN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410754 | Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant h |
CNY 3,080.00 |
|
| LY417607 | Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant reference |
CNY 3,080.00 |
|
| LY426854 | Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant ad |
CNY 3,080.00 |
|
| LY431255 | Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant y |
CNY 3,080.00 |
|
| LY432176 | Transient overexpression lysate of ataxin 3 (ATXN3), transcript variant e |
CNY 3,080.00 |
|
| TP318923 | Recombinant protein of human ataxin 3 (ATXN3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP710359 | Purified recombinant protein of Human ataxin 3 (ATXN3), transcript variant reference, full length, with with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
其它Ataxin 3产品
