CAMKK2 (NM_153499) Human Mass Spec Standard
CAT#: PH319152
CAMKK2 MS Standard C13 and N15-labeled recombinant protein (NP_705719)
View other "CAMKK2" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CAMKK2 MS Standard C13 and N15-labeled recombinant protein (NP_705719) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219152 |
Predicted MW | 59.6 kDa |
Protein Sequence |
>RC219152 representing NM_153499
Red=Cloning site Green=Tags(s) MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLAR DRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRL PRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR PPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPT LKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGT PAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTM IRKRSFGNPFEGSRREERSLSAPGNLLTKQGSEDNLQGTDPPPVGEEEVLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_705719 |
RefSeq Size | 5577 |
RefSeq ORF | 1623 |
Synonyms | CAMKK; CAMKKB |
Locus ID | 10645 |
Cytogenetics | 12q24.31 |
Summary | The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Protein Kinase, Transcription Factors |
Protein Pathways | Adipocytokine signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406744 | CAMKK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC406745 | CAMKK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC406746 | CAMKK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC407016 | CAMKK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC407017 | CAMKK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY406744 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 5 |
CNY 4,840.00 |
|
LY406745 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 6 |
CNY 4,840.00 |
|
LY406746 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 3 |
CNY 4,840.00 |
|
LY407016 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 2 |
CNY 4,840.00 |
|
LY407017 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 4 |
CNY 4,840.00 |
|
PH303468 | CAMKK2 MS Standard C13 and N15-labeled recombinant protein (NP_757380) |
CNY 19,520.00 |
|
TP303468 | Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7, 20 µg |
CNY 2,900.00 |
|
TP319152 | Recombinant protein of human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 2, 20 µg |
CNY 2,900.00 |