Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Mass Spec Standard
CAT#: PH319231
TRH MS Standard C13 and N15-labeled recombinant protein (NP_009048)
View other "Thyrotropin Releasing Hormone" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TRH MS Standard C13 and N15-labeled recombinant protein (NP_009048) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219231 |
Predicted MW | 27.4 kDa |
Protein Sequence |
>RC219231 protein sequence
Red=Cloning site Green=Tags(s) MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009048 |
RefSeq Size | 1890 |
RefSeq ORF | 726 |
Synonyms | Pro-TRH; TRF |
Locus ID | 7200 |
Cytogenetics | 3q22.1 |
Summary | This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. [provided by RefSeq, May 2013] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416185 | TRH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416185 | Transient overexpression lysate of thyrotropin-releasing hormone (TRH) |
CNY 3,080.00 |
|
TP319231 | Recombinant protein of human thyrotropin-releasing hormone (TRH), 20 µg |
CNY 2,900.00 |
其它Thyrotropin Releasing Hormone产品