United States
Germany
Japan
United Kingdom
China
PKM2 (PKM) (NM_182470) Human Mass Spec Standard
CAT＃: PH319382
PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872270)
View other "PKM2" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872270) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219382 |
| Predicted MW | 57.9 kDa |
| Protein Sequence |
>RC219382 representing NM_182470
Red=Cloning site Green=Tags(s) MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMN VARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATL KITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVN LPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRF DEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVAN AVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEAS YKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRV NFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_872270 |
| RefSeq Size | 2674 |
| RefSeq ORF | 1593 |
| Synonyms | CTHBP; HEL-S-30; OIP3; p58; PK3; PKM2; TCB; THBP1 |
| Locus ID | 5315 |
| Cytogenetics | 15q23 |
| Summary | This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported. [provided by RefSeq, May 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, Purine metabolism, Pyruvate metabolism, Type II diabetes mellitus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405537 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC405538 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC419188 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405537 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 2 |
CNY 4,840.00 |
|
| LY405538 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 3 |
CNY 4,840.00 |
|
| LY419188 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 1 |
CNY 3,080.00 |
|
| PH301855 | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_002645) |
CNY 19,520.00 |
|
| PH322698 | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872271) |
CNY 19,520.00 |
|
| TP301855 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP319382 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP322698 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP721212 | Purified recombinant protein of Human pyruvate kinase, muscle (PKM2), transcript variant 1 |
CNY 3,140.00 |
