United States
Germany
Japan
United Kingdom
China
FGFR4 (NM_022963) Human Mass Spec Standard
CAT＃: PH319813
FGFR4 MS Standard C13 and N15-labeled recombinant protein (NP_075252)
View other "FGFR4" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
| Cited in 1 publication. |
Product images
Specifications
| Product Data | |
| Description | FGFR4 MS Standard C13 and N15-labeled recombinant protein (NP_075252) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219813 |
| Predicted MW | 80.9 kDa |
| Protein Sequence |
>RC219813 representing NM_022963
Red=Cloning site Green=Tags(s) MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEG SRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDLSNRH SYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLV MESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPH IQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTV LPGTGRIPHLTCDSLTPAGRTKSPTLQFSLESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLW EFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRH KNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQS DVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLV EALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_075252 |
| RefSeq Size | 2807 |
| RefSeq ORF | 2286 |
| Synonyms | CD334; JTK2; TKF |
| Locus ID | 2264 |
| Cytogenetics | 5q35.2 |
| Summary | The protein encoded by this gene is a tyrosine kinase and cell surface receptor for fibroblast growth factors. The encoded protein is involved in the regulation of several pathways, including cell proliferation, cell differentiation, cell migration, lipid metabolism, bile acid biosynthesis, vitamin D metabolism, glucose uptake, and phosphate homeostasis. This protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment, and a cytoplasmic tyrosine kinase domain. The extracellular portion interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Endocytosis, MAPK signaling pathway, Regulation of actin cytoskeleton |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Nuclear localization of folate receptor alpha: a new role as a transcription factor
,null,
Scientific Reports
,PubMed ID 23243496
[FGFR4]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400735 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403876 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC411457 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC429711 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC431021 | FGFR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY400735 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 1 |
CNY 3,080.00 |
|
| LY403876 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 3 |
CNY 4,840.00 |
|
| LY411457 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 2 |
CNY 4,840.00 |
|
| LY429711 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 2 |
CNY 4,840.00 |
|
| LY431021 | Transient overexpression lysate of fibroblast growth factor receptor 4 (FGFR4), transcript variant 3 |
CNY 4,840.00 |
|
| TP319813 | Recombinant protein of human fibroblast growth factor receptor 4 (FGFR4), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP700125 | Purified recombinant protein of human fibroblast growth factor receptor 4 (FGFR4), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
