MZT2A (NM_001085365) Human Mass Spec Standard
CAT#: PH319963
FAM128A MS Standard C13 and N15-labeled recombinant protein (NP_001078834)
View other "MZT2A" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 3,080.00
Specifications
Product Data | |
Description | FAM128A MS Standard C13 and N15-labeled recombinant protein (NP_001078834) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219963 |
Predicted MW | 12.5 kDa |
Protein Sequence |
>RC219963 representing NM_001085365
Red=Cloning site Green=Tags(s) MELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRG RDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001078834 |
RefSeq Size | 708 |
RefSeq ORF | 363 |
Synonyms | FAM128A; MOZART2A |
Locus ID | 653784 |
Cytogenetics | 2q21.1 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421274 | MZT2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421274 | Transient overexpression lysate of family with sequence similarity 128, member A (FAM128A) |
CNY 3,080.00 |
|
TP319963 | Recombinant protein of human family with sequence similarity 128, member A (FAM128A), 20 µg |
CNY 2,900.00 |
|
TP710150 | Purified protein of Homo sapiens mitotic spindle organizing protein 2A (MZT2A), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |