TNFRSF18 (NM_004195) Human Mass Spec Standard
CAT#: PH319997
TNFRSF18 MS Standard C13 and N15-labeled recombinant protein (NP_004186)
View other "TNFRSF18" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TNFRSF18 MS Standard C13 and N15-labeled recombinant protein (NP_004186) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219997 |
Predicted MW | 26 kDa |
Protein Sequence |
>RC219997 representing NM_004195
Red=Cloning site Green=Tags(s) MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEW DCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFL TVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLLTSAQLGLHIWQLRSQCMWPRETQLLLEVPP STEDARSCQFPEEERGERSAEEKGRLGDLWV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004186 |
RefSeq Size | 1214 |
RefSeq ORF | 723 |
Synonyms | AITR; CD357; ENERGEN; GITR; GITR-D |
Locus ID | 8784 |
Cytogenetics | 1p36.33 |
Summary | This gene encodes a member of the TNF-receptor superfamily. The encoded receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407757 | TNFRSF18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418153 | TNFRSF18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407757 | Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 18 (TNFRSF18), transcript variant 2 |
CNY 3,080.00 |
|
LY418153 | Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 18 (TNFRSF18), transcript variant 1 |
CNY 3,080.00 |
|
TP319997 | Recombinant protein of human tumor necrosis factor receptor superfamily, member 18 (TNFRSF18), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP723941 | Human GITR Protein, hFc-His tag |
CNY 5,249.00 |
|
TP723942 | Human GITR Protein, mFc-His tag |
CNY 5,249.00 |
其它TNFRSF18产品